DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and arhgef9b

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_021336708.1 Gene:arhgef9b / 560923 ZFINID:ZDB-GENE-030131-7745 Length:573 Species:Danio rerio


Alignment Length:220 Identity:41/220 - (18%)
Similarity:76/220 - (34%) Gaps:78/220 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 QRFIYMAESSSRPAFQSIESLVSAIGNIASMLDSTFFALTSSFR-------AILGVATNFVRLRS 203
            :|.||  ...|.|.|.:.        |.:|:::........||:       :..|...|::|..|
Zfish   206 ERVIY--TKKSHPNFSNC--------NNSSVIEPEDSCAKQSFKIPQRRRWSRGGDVLNYLRRIS 260

  Fly   204 VFAQFWTTFA--IFRGLNWMYRKILYWLRLSNLDPSSAAFKKAFAEALNE---------NNGQAR 257
            :..:...|.|  .|..:|.:.:.|       :.|..|.:|:  ..:.||.         .:|..|
Zfish   261 LKGKGSQTLAESSFESMNTLDKTI-------DSDYGSVSFE--LVKDLNSAPEQSGVDGKSGHFR 316

  Fly   258 GAPNVPRKGNSPWPVLAFISFIFTAPYLIMKLLGTVTNTAQEEARNPAKWTAPIQTQAVYEFVAR 322
            |                           :::...||..||. :.||.::..:|.:.|        
Zfish   317 G---------------------------LLRFFNTVAETAM-KWRNSSRSFSPPEGQ-------- 345

  Fly   323 SPSELSLR----AGQMLHVAPRDIQ 343
             .|:|.||    :|:::...|..::
Zfish   346 -QSQLDLRKTQQSGELIQNTPLPVR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 27/161 (17%)
SH3_PEX13_eumet 312..373 CDD:212798 7/36 (19%)
arhgef9bXP_021336708.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.