DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and vav3b

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_005163380.1 Gene:vav3b / 559145 ZFINID:ZDB-GENE-070912-251 Length:853 Species:Danio rerio


Alignment Length:253 Identity:52/253 - (20%)
Similarity:85/253 - (33%) Gaps:75/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GAMGENDAEQRFIYMAESSSRPAFQSIESLVSAIG----------NIASMLDSTFFALTSSFRAI 191
            |.|..:.||...:....|:....::|.||...||.          .:.:.....:.|.:.:|:.:
Zfish   662 GPMERHHAESELMERENSTYLVRYRSRESREYAISIKYNNDVKHLKVLTKEGCFYIAESRTFKNV 726

  Fly   192 LGVATNFVR--LRSVFAQFWTTFAI-FRGLNWMYRKILYWL-RLSNLDPSSAAFKKAFAEALNEN 252
            ||:...:.:  |:..|....||..: |:.|....|.....| .||.|.|:|..|           
Zfish   727 LGLVEYYKQHSLKEGFRTLDTTLQVPFKELGTGLRTAAPVLCGLSVLSPTSYNF----------- 780

  Fly   253 NGQARGAPNVPRKGNSPWPVLAFISFIFTAPYLIMKLLGTVTNTAQEEARNPAKWTAPIQTQAVY 317
                     ||...:..|.||.            .::||...                    |.|
Zfish   781 ---------VPPSPSPFWSVLT------------PRVLGIAL--------------------ARY 804

  Fly   318 EFVARSPSELSLRAGQMLHVAPRDIQQTLNLLNTGWALATTNGQTSGIIPISYVKSPQ 375
            :|.:|...||||:.|.::.:..:        ...||.....||:. |..|.:||:..:
Zfish   805 DFSSRDTRELSLQVGDLVKIYIK--------CTNGWWKGEVNGRV-GWFPSTYVEEEE 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 31/163 (19%)
SH3_PEX13_eumet 312..373 CDD:212798 17/60 (28%)
vav3bXP_005163380.1 CH 4..115 CDD:278723
RhoGEF 194..368 CDD:279015
PH_Vav 381..503 CDD:269930
PH 406..499 CDD:278594
C1 511..556 CDD:237996
SH3 585..644 CDD:302595
SH2 653..755 CDD:301589 19/92 (21%)
SH3_VAV3_2 798..852 CDD:212911 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.