DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and vav2

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_021324720.1 Gene:vav2 / 556413 ZFINID:ZDB-GENE-091204-420 Length:891 Species:Danio rerio


Alignment Length:108 Identity:31/108 - (28%)
Similarity:46/108 - (42%) Gaps:20/108 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 SPWPVLAFISFIFTAPYLIMKLLGTVTNTAQEEARNPAKWTAPIQTQAV--YEFVARSPSELSLR 330
            ||....|..:|.|.:|.       .:..::|..|...:.:|..:.:.||  |.|.||...|||||
Zfish   794 SPAATCASYNFSFLSPQ-------GLNFSSQSSAPFWSVFTPRVVSTAVARYNFAARDMRELSLR 851

  Fly   331 AGQMLHVAPRDIQQTLNLL--NTGWALATTNGQTSGIIPISYV 371
            .|        ||.:..:.:  :.||.....||:. |..|.:||
Zfish   852 EG--------DIVKIYSKIGGDQGWWKGEANGRI-GWFPSTYV 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 6/21 (29%)
SH3_PEX13_eumet 312..373 CDD:212798 22/64 (34%)
vav2XP_021324720.1 CAMSAP_CH 18..103 CDD:314792
RhoGEF 211..386 CDD:238091
PH_Vav 401..528 CDD:269930
C1 536..579 CDD:237996
SH3 601..660 CDD:327375
SH2_Vav2 680..782 CDD:198269
SH3_VAV2_2 832..889 CDD:212910 22/63 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.