DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and Vav

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001097030.1 Gene:Vav / 32920 FlyBaseID:FBgn0040068 Length:1001 Species:Drosophila melanogaster


Alignment Length:161 Identity:35/161 - (21%)
Similarity:63/161 - (39%) Gaps:17/161 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 YWLRLSNLDPSSAAFKKAFAEALNENNGQARGAP-NVPRKGNSPWPVLA----FISFIFTAPYLI 286
            |.||:....||: |.:..:|.:|..::...:... |....|:|....|:    |.:.:....|..
  Fly   852 YLLRVRPQGPST-AHETMYALSLKTDDNVIKHMKINQENSGDSMLYCLSSRRHFKTIVELVSYYE 915

  Fly   287 MKLLGTVTNTAQEEARNPAKWTAPIQTQAVYEFVARSPS-ELSLRAGQMLHVAPRDIQQTLNLLN 350
            ...||.......:..:.|.|   .:...|:|::..::.| :|.||....:.|..:|..      :
  Fly   916 RNDLGENFAGLNQSLQWPY
K---EVIATALYDYEPKAGSNQLQLRTDCQVLVIGKDGD------S 971

  Fly   351 TGWALATTNGQTSGIIPISYVKSPQQMRQEM 381
            .||..... |.|.|..|..||:..:...:|:
  Fly   972 KGWWRGKI-GDTVGYFPKEYVQEQKLASEEL 1001

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 14/67 (21%)
SH3_PEX13_eumet 312..373 CDD:212798 16/61 (26%)
VavNP_001097030.1 CH 20..132 CDD:278723
RhoGEF 428..603 CDD:279015
PH_Vav 624..753 CDD:269930
PH 641..749 CDD:278594
C1_1 761..804 CDD:278556
SH2_Vav_family 824..934 CDD:198193 16/82 (20%)
SH3 940..993 CDD:302595 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.