DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and Plekhg3

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_006515932.1 Gene:Plekhg3 / 263406 MGIID:2388284 Length:1362 Species:Mus musculus


Alignment Length:233 Identity:51/233 - (21%)
Similarity:91/233 - (39%) Gaps:59/233 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SNLDPSSAAFKKAFAEALNENNGQARGAP---NVPRKGN--SPW-----PVLAFISFIFTAP-YL 285
            |:.|..||..:...:||..:|   ..|:|   :||...|  |.|     |:..|.....|:| |.
Mouse    49 SSRDSHSAMEEPTGSEASAQN---GTGSPWDRHVPNSNNNSSGWLNMKGPLSPFNGRAGTSPAYH 110

  Fly   286 IMKLLGTVTNTAQEEARNPAKWTAPIQTQAVYEFVARS-----------------PSELSLRAG- 332
            .:..||.|....             ::|:.:|....||                 |.::|...| 
Mouse   111 KLSYLGRVVREI-------------VETERMYVQDLRSIVEDYLLKIIDTPGLLKPEQVSALFGN 162

  Fly   333 -QMLHVAPRDIQQTLNLLNTG-WALATTNGQTSGIIPI------SYVKSPQQMRQEMQD--QTKP 387
             :.::.....:.:.|:..|:. .|:|:...:.|....|      :|..|...:.:.|||  |.|.
Mouse   163 IESIYALNSQLLRDLDSCNSDPVAVASCFVERSQEFDIYTQYCNNYPNSVAALTECMQDKQQAKF 227

  Fly   388 AQPQPELM--NLSAGAFASPPLEQQMNYDFNLAAQQQA 423
            .:.:.||:  :|..|::...|:::.:.|  :|..|:.|
Mouse   228 FRDRQELLQHSLPLGSYLLKPVQRVLKY--HLLLQEIA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 19/68 (28%)
SH3_PEX13_eumet 312..373 CDD:212798 14/86 (16%)
Plekhg3XP_006515932.1 RhoGEF 118..292 CDD:214619 30/161 (19%)
PH_PLEKHG1_G2_G3 274..417 CDD:270063
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.