DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and scd1

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_594221.1 Gene:scd1 / 2542337 PomBaseID:SPAC16E8.09 Length:872 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:42/204 - (20%)
Similarity:70/204 - (34%) Gaps:66/204 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 MYRKIL-YWLRLSNLDPSSAAFKKAFAEALNENNGQARGAPNVPRKGNSPWPVLAFISFIFTAP- 283
            :||:.| ...||.::...:|.|.....|||                 ||.:.:|.|....|..| 
pombe    60 LYRRCLNLRKRLMDISELAAFFDSIHREAL-----------------NSSFKILEFKDIEFDDPV 107

  Fly   284 ----------YLIMKLLG--------TVTNTAQEEARNPAKWTAPIQTQAVYEFVARSPSELSLR 330
                      |.:..|..        .|.::...|..|..|       .::|.|:....:||.|.
pombe   108 TEIWLFCRLGYPLCALFNCLPVKQKLEVNSSVSLENTNVCK-------ASLYRFMLMCKNELGLT 165

  Fly   331 AGQMLHV--------AP--RDIQQTLNLL-------NTGWALATTNGQTSGIIPI----SYVKSP 374
            ...:..:        ||  |.: ||:.||       ||..:.:|.:..|...:|.    |.:.|.
pombe   166 DAALFSISEIYKPSTAPLVRAL-QTIELLLKKYEVSNTTKSSSTPSPSTDDNVPTGTLNSLIASG 229

  Fly   375 QQMRQEMQD 383
            :::..|:.:
pombe   230 RRVTAELYE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 17/80 (21%)
SH3_PEX13_eumet 312..373 CDD:212798 18/81 (22%)
scd1NP_594221.1 CDC24 105..194 CDD:283938 18/96 (19%)
RhoGEF 232..401 CDD:279015 1/7 (14%)
PH_Scd1 404..546 CDD:270066
PB1 775..848 CDD:214770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.