Sequence 1: | NP_610850.1 | Gene: | Pex13 / 36462 | FlyBaseID: | FBgn0033812 | Length: | 440 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_594221.1 | Gene: | scd1 / 2542337 | PomBaseID: | SPAC16E8.09 | Length: | 872 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 204 | Identity: | 42/204 - (20%) |
---|---|---|---|
Similarity: | 70/204 - (34%) | Gaps: | 66/204 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 221 MYRKIL-YWLRLSNLDPSSAAFKKAFAEALNENNGQARGAPNVPRKGNSPWPVLAFISFIFTAP- 283
Fly 284 ----------YLIMKLLG--------TVTNTAQEEARNPAKWTAPIQTQAVYEFVARSPSELSLR 330
Fly 331 AGQMLHV--------AP--RDIQQTLNLL-------NTGWALATTNGQTSGIIPI----SYVKSP 374
Fly 375 QQMRQEMQD 383 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pex13 | NP_610850.1 | Peroxin-13_N | 140..290 | CDD:282008 | 17/80 (21%) |
SH3_PEX13_eumet | 312..373 | CDD:212798 | 18/81 (22%) | ||
scd1 | NP_594221.1 | CDC24 | 105..194 | CDD:283938 | 18/96 (19%) |
RhoGEF | 232..401 | CDD:279015 | 1/7 (14%) | ||
PH_Scd1 | 404..546 | CDD:270066 | |||
PB1 | 775..848 | CDD:214770 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1291 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |