DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and Vav1

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_035821.3 Gene:Vav1 / 22324 MGIID:98923 Length:845 Species:Mus musculus


Alignment Length:73 Identity:24/73 - (32%)
Similarity:36/73 - (49%) Gaps:9/73 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 ARNPAKWTAPIQT-QAVYEFVARSPSELSLRAGQMLHVAPRDIQQTLNLLNTGWALATTNGQTSG 364
            ::.||..|....| :|.|:|.||..|||||:.|.::.:..:..||       ||......|:. |
Mouse   774 SKPPAGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQ-------GWWRGEIYGRI-G 830

  Fly   365 IIPISYVK 372
            ..|.:||:
Mouse   831 WFPSNYVE 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008
SH3_PEX13_eumet 312..373 CDD:212798 21/62 (34%)
Vav1NP_035821.3 CH 18..102 CDD:320720
RhoGEF 195..371 CDD:238091
PH_Vav 385..508 CDD:269930
C1_1 516..567 CDD:278556
SH3_VAV1_1 596..658 CDD:212912
SH2_Vav1 665..767 CDD:198268
SH3_VAV1_2 786..839 CDD:212909 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.