DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and Spata13

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_036014454.1 Gene:Spata13 / 219140 MGIID:104838 Length:1295 Species:Mus musculus


Alignment Length:98 Identity:21/98 - (21%)
Similarity:39/98 - (39%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 QAVYEFVARSPSELSLRAGQMLHVAPRDIQQTLNLLNTGWALATTNGQTSGIIPISYVKSPQQMR 378
            :|:::.|.....||..:||        |:.|.|...|..|... .|.......|.|:|:. :..:
Mouse   796 EALWDHVTMDDQELGFKAG--------DVIQVLEASNKDWWWG-RNEDKEAWFPASFVRL-RVNQ 850

  Fly   379 QEMQDQTKPAQPQPELMNLSAGAFASPPLEQQM 411
            :|:.:....:..:.:..:.|......|..:|||
Mouse   851 EELPENCSSSHGEEQDEDTSKARHKHPESQQQM 883

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008
SH3_PEX13_eumet 312..373 CDD:212798 15/58 (26%)
Spata13XP_036014454.1 PHA03247 <251..497 CDD:223021
SH3_ASEF 777..848 CDD:212906 15/61 (25%)
RhoGEF 887..1066 CDD:214619
PH_Collybistin_ASEF 1071..1209 CDD:269931
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.