DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and vav-1

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001359918.1 Gene:vav-1 / 181153 WormBaseID:WBGene00006887 Length:1007 Species:Caenorhabditis elegans


Alignment Length:61 Identity:20/61 - (32%)
Similarity:31/61 - (50%) Gaps:7/61 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 QAVYEFVARSPSELSLRAGQMLHVAPRDIQQTLNLL--NTGWALATTNGQTSGIIPISYVK 372
            :||:::.|.||:    ..|:.|.....||...|:.:  :.||.....|.: ||..|:||||
 Worm   932 KAVHDYDAPSPN----NEGKFLSFKTGDIVVLLDTVGEDRGWWKGQVNNK-SGFFPLSYVK 987

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008
SH3_PEX13_eumet 312..373 CDD:212798 20/61 (33%)
vav-1NP_001359918.1 CH 38..149 CDD:237981
RhoGEF 241..435 CDD:238091
PH_Vav 453..602 CDD:269930
C1 616..657 CDD:237996
SH3 693..746 CDD:388381
SH2_Vav_family 825..925 CDD:198193
SH3 927..987 CDD:214620 18/59 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.