powered by:
Protein Alignment Pex13 and vav-1
DIOPT Version :9
Sequence 1: | NP_610850.1 |
Gene: | Pex13 / 36462 |
FlyBaseID: | FBgn0033812 |
Length: | 440 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001359918.1 |
Gene: | vav-1 / 181153 |
WormBaseID: | WBGene00006887 |
Length: | 1007 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 20/61 - (32%) |
Similarity: | 31/61 - (50%) |
Gaps: | 7/61 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 314 QAVYEFVARSPSELSLRAGQMLHVAPRDIQQTLNLL--NTGWALATTNGQTSGIIPISYVK 372
:||:::.|.||: ..|:.|.....||...|:.: :.||.....|.: ||..|:||||
Worm 932 KAVHDYDAPSPN----NEGKFLSFKTGDIVVLLDTVGEDRGWWKGQVNNK-SGFFPLSYVK 987
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1291 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.