DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and uig-1

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001256489.1 Gene:uig-1 / 179808 WormBaseID:WBGene00009337 Length:972 Species:Caenorhabditis elegans


Alignment Length:235 Identity:49/235 - (20%)
Similarity:81/235 - (34%) Gaps:65/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 DPSSAAF---KKAFAEALN-----ENNGQAR-------GAPNVPRKGNSPWPVLAFISF-IFTAP 283
            :|:|||.   :..:.:|.|     .:|.::|       |...:.|..:..:..|  :|| ..|.|
 Worm   740 EPNSAAVMSSRSRYQQARNRRLPPRHNQESRSTSSRRMGEEEIDRTFDQLYEEL--VSFGDSTKP 802

  Fly   284 YLIMKLLGTVTNTAQEEARNPAKWTAPIQTQAVYEFVARSPSELSLRAGQMLHVAPRDIQQTLNL 348
                    |||:...:..|:.|.     |:......||.:|:..:|...:..:...|  .::|..
 Worm   803 --------TVTSNRSQRLRSEAP-----QSTVTTITVAATPATATLSIAECANTRLR--SKSLTR 852

  Fly   349 LNTGWALATTNGQTSGIIPIS--------YVKSPQQMRQEMQDQTKPAQPQPELMNLSAGAFA-- 403
            |:...|           .|||        |.|..|..::..:.|........:::..|.|.|:  
 Worm   853 LDEYEA-----------EPISLKPSIERRYSKVDQLKKRSRKYQVNQEPEAADVLRPSVGRFSLT 906

  Fly   404 ---------SPPLEQQMNYDFNLAAQQQAPLGP--PSTTS 432
                     .|...........|.|||.|.|..  ||:.|
 Worm   907 DHEIIIHGEEPYKRSSGRQRTPLTAQQTAELDDYFPSSNS 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 15/70 (21%)
SH3_PEX13_eumet 312..373 CDD:212798 13/68 (19%)
uig-1NP_001256489.1 RhoGEF 280..458 CDD:214619
PH_PLEKHG1_G2_G3 439..590 CDD:270063
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.