DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and Y106G6H.14

DIOPT Version :10

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_492738.1 Gene:Y106G6H.14 / 172926 WormBaseID:WBGene00013724 Length:220 Species:Caenorhabditis elegans


Alignment Length:60 Identity:21/60 - (35%)
Similarity:34/60 - (56%) Gaps:8/60 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 QAVYEFVARSPSELSLRAGQMLHVAPRDIQQTLNLLNTGWALATTNGQTSGIIPISYVKS 373
            :|:|:|.|||..||:...|.:::|:  |.|.     |..|..|:..|: .|::|.:||.|
 Worm    23 RALYDFQARSAQELTFSEGDLMYVS--DEQP-----NKDWFQASIGGK-KGLVPANYVIS 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 147..290 CDD:461167
SH3_PEX13_eumet 312..373 CDD:212798 20/58 (34%)
Y106G6H.14NP_492738.1 SH3_OSTF1 21..74 CDD:212706 20/58 (34%)
ANKYR <63..>183 CDD:440430 5/13 (38%)
ANK repeat 83..110 CDD:293786
ANK repeat 112..144 CDD:293786
ANK repeat 146..177 CDD:293786
Ank_2 151..220 CDD:463710
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.