DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex13 and VAV3

DIOPT Version :9

Sequence 1:NP_610850.1 Gene:Pex13 / 36462 FlyBaseID:FBgn0033812 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_006104.4 Gene:VAV3 / 10451 HGNCID:12659 Length:847 Species:Homo sapiens


Alignment Length:251 Identity:53/251 - (21%)
Similarity:82/251 - (32%) Gaps:90/251 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GAMGENDAEQRFIYMAESSSRPAFQSIESLVSAIG--------NIASMLDSTFFALTSS--FRAI 191
            |||....||...|....|:.....::.||...||.        :|..:....||.:..:  |:::
Human   675 GAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSL 739

  Fly   192 LGVATNFVR--LRSVFAQFWTTFAIFRGLNWMYRKILYWLRLSNLDPSSAAFKKAFAEALNENNG 254
            :.:...:..  |:..|....||      |.:.|:           :|..:|             |
Human   740 MELVEYYKHHSLKEGFRTLDTT------LQFPYK-----------EPEHSA-------------G 774

  Fly   255 QARGAPNVPRKGNSPWPVLAFISFIFTAPYLIMKLLGTVTNTAQEEARNPAKWTAPIQTQAVYEF 319
            | ||    .|.|||               .|..|:||...                    |.|:|
Human   775 Q-RG----NRAGNS---------------LLSPKVLGIAI--------------------ARYDF 799

  Fly   320 VARSPSELSLRAGQMLHVAPRDIQQTLNLLNTGWALATTNGQTSGIIPISYVKSPQ 375
            .||...||||..|.::.:..:       :...||.....||:. |..|.:||:..:
Human   800 CARDMRELSLLKGDVVKIYTK-------MSANGWWRGEVNGRV-GWFPSTYVEEDE 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex13NP_610850.1 Peroxin-13_N 140..290 CDD:282008 30/161 (19%)
SH3_PEX13_eumet 312..373 CDD:212798 18/60 (30%)
VAV3NP_006104.4 CAMSAP_CH 18..103 CDD:288798
RhoGEF 193..369 CDD:238091
PH_Vav 383..506 CDD:269930
PH 407..502 CDD:278594
C1 514..561 CDD:237996
Sufficient for interaction with ROS1. /evidence=ECO:0000269|PubMed:11094073 560..847 53/249 (21%)
SH3_VAV3_1 596..657 CDD:212914
SH2_Vav3 666..768 CDD:198270 21/109 (19%)
SH3_VAV3_2 791..846 CDD:212911 19/82 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.