Sequence 1: | NP_610850.1 | Gene: | Pex13 / 36462 | FlyBaseID: | FBgn0033812 | Length: | 440 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006539499.1 | Gene: | Plekhg2 / 101497 | MGIID: | 2141874 | Length: | 1366 | Species: | Mus musculus |
Alignment Length: | 298 | Identity: | 63/298 - (21%) |
---|---|---|---|
Similarity: | 100/298 - (33%) | Gaps: | 123/298 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 LSNLDPSSAAFKKAFAEALNENNGQARGAPNVPRKGNSP-WPVLAFISFIFTAPYLIMKLLGTVT 294
Fly 295 NTAQE---EARNPA----KW-TAPIQTQAVYEFVAR-------------SPSE------------ 326
Fly 327 ----LSLRAGQMLHVAPRDIQ-QTLNLLNTGW-AL------------------------ATTNGQ 361
Fly 362 TSGIIPIS-------------YVKSPQQM-RQEMQDQT-----KP---AQPQPELMNLSAGAFAS 404
Fly 405 PPLEQ---------------QMNYDFNLAAQQQAPLGP 427 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pex13 | NP_610850.1 | Peroxin-13_N | 140..290 | CDD:282008 | 17/59 (29%) |
SH3_PEX13_eumet | 312..373 | CDD:212798 | 19/128 (15%) | ||
Plekhg2 | XP_006539499.1 | RhoGEF | 103..278 | CDD:366202 | |
PH_PLEKHG1_G2_G3 | 260..410 | CDD:270063 | |||
PTZ00449 | <351..742 | CDD:185628 | 28/116 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1291 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |