DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fsn and Spsb3

DIOPT Version :9

Sequence 1:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_006525228.1 Gene:Spsb3 / 79043 MGIID:1891471 Length:525 Species:Mus musculus


Alignment Length:233 Identity:62/233 - (26%)
Similarity:89/233 - (38%) Gaps:66/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DENSDVWRWHCLNKLPKESLKSDLLASVSTYKTKLRAYFHAWSPNDCSRNVYIKPNGFTLHRNPV 106
            ||:.| |.|..|||      .|..|.|....|..    ||  ....|                  
Mouse   246 DEDFD-WVWDDLNK------SSATLLSCDNRKVS----FH--MEYSC------------------ 279

  Fly   107 AQSTDAARGKIGFRHGRHTWEVIWEGPL-GTVAVIGISTKEAALQ--CHGYVALLGSDDQS---- 164
              .|.|.||......|:|.||:....|: ||..::||.|.:..|.  .|.:.:|||.|:.|    
Mouse   280 --GTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLS 342

  Fly   165 ----------WGWN----------LVENHLLHNGDMQGSYPLLNNAPKYQVGERIRVILDCEDNT 209
                      |||.          |:...|.|.|| :.|:     :.::..|..|.|.||....|
Mouse   343 YTGRCCLGHGWGWQYSRPPRITPLLLAGLLHHKGD-KTSF-----SSRFGQGSIIGVHLDTWHGT 401

  Fly   210 LSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMV 247
            |:|.||.:.:|||...|.:::.||.|.:....:.:.::
Mouse   402 LTFFKNRKCIGVAATRLQNRRFYPMVCSTAAKSSMKVI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsnNP_610849.1 F-box-like 13..54 CDD:289689 5/11 (45%)
SPRY_Fbox 81..255 CDD:293964 49/194 (25%)
Spsb3XP_006525228.1 SPRY_SOCS3 250..457 CDD:293936 60/229 (26%)
SOCS 447..483 CDD:383010
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.