Sequence 1: | NP_610849.1 | Gene: | Fsn / 36460 | FlyBaseID: | FBgn0043010 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001243571.1 | Gene: | spsb4a / 557906 | ZFINID: | ZDB-GENE-070911-3 | Length: | 277 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 85/196 - (43%) |
---|---|---|---|
Similarity: | 124/196 - (63%) | Gaps: | 13/196 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 DLLASV--STYKTKLRAYFHAWSPNDCSRNVYIKPNG-FTLHRNPVAQSTDAARGKIGFRHGRHT 125
Fly 126 WEVIWEG-PLGTVAVIGISTKEAALQCHGYVALLGSDDQSWGWNLVENHLLHN-----GDMQGSY 184
Fly 185 P-LLNNAPKYQVGERIRVILDCEDNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMVY 248
Fly 249 L 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fsn | NP_610849.1 | F-box-like | 13..54 | CDD:289689 | |
SPRY_Fbox | 81..255 | CDD:293964 | 79/177 (45%) | ||
spsb4a | NP_001243571.1 | SPRY_SOCS1-2-4 | 55..231 | CDD:293963 | 78/175 (45%) |
SOCS_SSB1_4 | 236..277 | CDD:239688 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3953 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |