DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fsn and spsb4b

DIOPT Version :9

Sequence 1:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001003474.1 Gene:spsb4b / 445080 ZFINID:ZDB-GENE-040801-213 Length:281 Species:Danio rerio


Alignment Length:181 Identity:84/181 - (46%)
Similarity:112/181 - (61%) Gaps:14/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HAWSPNDCSRNVYIKPNG-FTLHRNPVAQSTDAARGKIGFRHGRHTWEVIWEGPL---GTVAVIG 141
            |||:|:|.|.|::||.:. .|.||:|||||||..|||.||..|.|.|.:.|  |:   ||.||:|
Zfish    57 HAWNPDDRSPNLFIKDDDRLTFHRHPVAQSTDCVRGKTGFTRGLHAWSLRW--PVRQRGTHAVVG 119

  Fly   142 ISTKEAALQCHGYVALLGSDDQSWGWNLVENHLLHNGDMQGS----YPLL----NNAPKYQVGER 198
            ::|..|.|:..||.||:|||.:||||:|....|.|:...:..    ||..    :....:.|.|.
Zfish   120 VATSLATLRAVGYSALVGSDAESWGWDLGRGRLYHDRKSRSGPAPPYPEFVEDEDEEGTFSVPEE 184

  Fly   199 IRVILDCEDNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMVYL 249
            |.|:||.::.||.|..:..:||||||||..|:|||.||||:|:.||||.|:
Zfish   185 ILVVLDMDEGTLGFCADGNYLGVAFRGLKGKRLYPIVSAVWGHCEVSMNYI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsnNP_610849.1 F-box-like 13..54 CDD:289689
SPRY_Fbox 81..255 CDD:293964 84/181 (46%)
spsb4bNP_001003474.1 SPRY_SOCS1-2-4 57..235 CDD:293963 83/179 (46%)
SOCS_SSB4 240..281 CDD:239712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.