DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fsn and gus

DIOPT Version :9

Sequence 1:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001246140.1 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster


Alignment Length:177 Identity:82/177 - (46%)
Similarity:116/177 - (65%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HAWSPNDCSRNVYIKPNG-FTLHRNPVAQSTDAARGKIGFRHGRHTWEVIWEGPL---GTVAVIG 141
            |:|:..|.|.|:::|.:. .|.||:|||||||..|||:|...|.|.||:.|  |.   ||.||:|
  Fly    56 HSWNSEDRSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYW--PTRQRGTHAVVG 118

  Fly   142 ISTKEAALQCHGYVALLGSDDQSWGWNLVENHLLHNG-DMQG-SYP-LLNNAPKYQVGERIRVIL 203
            :.|.:|.|...||.:|:||.:|||||:|..|.|.|:. :..| :|| :|.|...:.|.::..|.|
  Fly   119 VCTADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVAL 183

  Fly   204 DCEDNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMVYLG 250
            |.::.||||..:.::||:|||||..|||||.||||:|:.|::|.|:|
  Fly   184 DMDEGTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYIG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsnNP_610849.1 F-box-like 13..54 CDD:289689
SPRY_Fbox 81..255 CDD:293964 82/177 (46%)
gusNP_001246140.1 SPRY_SOCS1-2-4 56..229 CDD:293963 80/174 (46%)
SOCS_SSB1_4 234..276 CDD:239688
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469107
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.