Sequence 1: | NP_610849.1 | Gene: | Fsn / 36460 | FlyBaseID: | FBgn0043010 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020631.1 | Gene: | spsb1 / 334190 | ZFINID: | ZDB-GENE-030131-6122 | Length: | 273 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 86/206 - (41%) |
---|---|---|---|
Similarity: | 127/206 - (61%) | Gaps: | 12/206 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 KLPKESL------KSDLLASVSTYKTKLRAYFHAWSPNDCSRNVYIK-PNGFTLHRNPVAQSTDA 112
Fly 113 ARGKIGFRHGRHTWEVIWE-GPLGTVAVIGISTKEAALQCHGYVALLGSDDQSWGWNLVENHLLH 176
Fly 177 NGDMQGS--YP-LLNNAPKYQVGERIRVILDCEDNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAV 238
Fly 239 YGNTEVSMVYL 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fsn | NP_610849.1 | F-box-like | 13..54 | CDD:289689 | |
SPRY_Fbox | 81..255 | CDD:293964 | 81/174 (47%) | ||
spsb1 | NP_001020631.1 | SPRY_SOCS1-2-4 | 54..227 | CDD:293963 | 80/172 (47%) |
SOCS_SSB1_4 | 232..273 | CDD:239688 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3953 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |