DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fsn and spsb-2

DIOPT Version :9

Sequence 1:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_497320.2 Gene:spsb-2 / 266877 WormBaseID:WBGene00021596 Length:243 Species:Caenorhabditis elegans


Alignment Length:173 Identity:73/173 - (42%)
Similarity:108/173 - (62%) Gaps:3/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HAWSPNDCSRNVYIK-PNGFTLHRNPVAQSTDAARGKIGFRHGRHTWEVIW-EGPLGTVAVIGIS 143
            |:|:|:|.|.|:.:| .:..||:|:||...||..|||:|:..|.|.|::.| |...||.||:|::
 Worm    25 HSWNPDDRSPNIIVKDQDKLTLYRHPVPNCTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVA 89

  Fly   144 TKEAALQCHGYVALLGSDDQSWGWNLVENHLLHNGDMQGSYPLLNNAPKYQVGERIRVILDCEDN 208
            ||.|.||...|..|:||:::|:|||:.... .|.|..:..||..|....:.|.|:|..|||.|..
 Worm    90 TKNAPLQAAEYTTLVGSNNESYGWNIATRE-CHYGSWKWKYPYGNGRDGFNVPEKIYCILDMEQG 153

  Fly   209 TLSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMVYLGT 251
            .|||..:.|:|||.|:.|..|:|||.|:.:||:.|::|.:||:
 Worm   154 NLSFATDNEYLGVVFQNLRGKRLYPAVATLYGDCEITMTHLGS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsnNP_610849.1 F-box-like 13..54 CDD:289689
SPRY_Fbox 81..255 CDD:293964 73/173 (42%)
spsb-2NP_497320.2 SPRY_SOCS1-2-4 25..194 CDD:293963 71/169 (42%)
SOCS_SSB1_4 200..241 CDD:239688
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.