DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fsn and spsb-1

DIOPT Version :9

Sequence 1:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_497321.3 Gene:spsb-1 / 266876 WormBaseID:WBGene00021597 Length:483 Species:Caenorhabditis elegans


Alignment Length:175 Identity:79/175 - (45%)
Similarity:113/175 - (64%) Gaps:4/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HAWSPNDCSRNVYIK-PNGFTLHRNPVAQSTDAARGKIGFRHGRHTWEVIW-EGPLGTVAVIGIS 143
            |:|:|.|.|.|:::| .:.||.||:|||||||..|||:|:..|.|.|::.| |...||.||:|::
 Worm   131 HSWNPEDRSLNIFVKDEDKFTFHRHPVAQSTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVA 195

  Fly   144 TKEAALQCHGYVALLGSDDQSWGWNLVENHLLHNG--DMQGSYPLLNNAPKYQVGERIRVILDCE 206
            ||.|.|...||.||:|:.|:|:||::......|:.  .|...||..|:...|.|.::...|||.:
 Worm   196 TKNAPLHAAGYTALIGTTDESYGWDITRRECHHDSKHTMTWRYPFSNSRDVYNVPDKFYCILDMD 260

  Fly   207 DNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMVYLGT 251
            :..::|..:.||||||||.|..|.|||.|:||:|:.|:||.|||:
 Worm   261 EGYMAFATDDEFLGVAFRNLKGKTLYPIVAAVWGHCEISMRYLGS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsnNP_610849.1 F-box-like 13..54 CDD:289689
SPRY_Fbox 81..255 CDD:293964 79/175 (45%)
spsb-1NP_497321.3 SPRY_SOCS1-2-4 131..303 CDD:293963 76/171 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.