DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fsn and SPCC1259.12c

DIOPT Version :9

Sequence 1:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_588068.2 Gene:SPCC1259.12c / 2538867 PomBaseID:SPCC1259.12c Length:491 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:41/162 - (25%)
Similarity:73/162 - (45%) Gaps:20/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 AWSPNDCSRNVYIKPNGFTLH-RNPVAQST-DAARGKIGFRHGRHTWEVIWEGPL---GTVAVIG 141
            :|:|||.|.::.:..|...:: ..|.|.:. |||..|.......:|....:|..:   |....:|
pombe    74 SWNPNDKSDSLELMNNNMGVYFFGPEAGTEHDAASVKADHAIPSNTSIYYYEIQILSRGKEGKMG 138

  Fly   142 ISTKEAALQCHGYVALLGSDDQSWGW--NLVEN-HLLHNGDMQGSYPLLNNAPKYQVGERIRVIL 203
            :.....::|.:   .|.|...:|||:  |..|. :....|:..|        |::..|:.|...:
pombe   139 VGFCRKSMQTN---RLPGCTAESWGYHGNSGEKFNCSKTGEAYG--------PEFTTGDIIGCGV 192

  Fly   204 DCEDNTLSFEKNYEFLGVAFRGLPDKKLYPTV 235
            :..:.|:.:.||..:|||||:.:.| .|||.:
pombe   193 NFINRTIFYTKNGAYLGVAFKKVSD-VLYPVI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsnNP_610849.1 F-box-like 13..54 CDD:289689
SPRY_Fbox 81..255 CDD:293964 41/162 (25%)
SPCC1259.12cNP_588068.2 SPRY_RanBP9_10 102..238 CDD:293966 33/134 (25%)
LisH 274..299 CDD:285685
CTLH 308..361 CDD:128914
CLTH 309..470 CDD:287564
CRA 381..475 CDD:214806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.