Sequence 1: | NP_610849.1 | Gene: | Fsn / 36460 | FlyBaseID: | FBgn0043010 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001292979.1 | Gene: | Spsb2 / 14794 | MGIID: | 1315199 | Length: | 264 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 85/206 - (41%) |
---|---|---|---|
Similarity: | 111/206 - (53%) | Gaps: | 24/206 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 PKESLKS-------DLLASVSTYKTKLRAYFHAWSPNDCSRNVYIKPNGFTLHRNPVAQSTDAAR 114
Fly 115 GKIGFRHGRHTWEVIWEGPL---GTVAVIGISTKEAALQCHGYVALLGSDDQSWGWNLVENHLLH 176
Fly 177 --NGDMQGSYPLLNNAPKYQVGERIRVILDCEDNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAVY 239
Fly 240 GNTEVSMVYLG 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fsn | NP_610849.1 | F-box-like | 13..54 | CDD:289689 | |
SPRY_Fbox | 81..255 | CDD:293964 | 79/175 (45%) | ||
Spsb2 | NP_001292979.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..34 | 3/8 (38%) | |
SPRY_SOCS1-2-4 | 46..217 | CDD:293963 | 77/172 (45%) | ||
SOCS_SSB2 | 223..264 | CDD:239689 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3953 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |