DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fsn and si:ch1073-228j22.2

DIOPT Version :9

Sequence 1:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_021325532.1 Gene:si:ch1073-228j22.2 / 100334514 ZFINID:ZDB-GENE-110411-227 Length:285 Species:Danio rerio


Alignment Length:175 Identity:74/175 - (42%)
Similarity:101/175 - (57%) Gaps:3/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 WSPNDCSRNVYIKPNGFTLHRNPVAQSTDAARGKIGFRHGRHTWEVIWEG-PLGTVAVIGISTKE 146
            |||...|.|:....:|..:||..|.||:||||..||...|.|.|||.||| ..|:.|::|:||.:
Zfish    53 WSPTHLSPNLQRCVSGVRVHRGHVEQSSDAARAAIGTSTGLHIWEVKWEGQQRGSHALLGVSTHK 117

  Fly   147 AALQCHGYVALLGSDDQSWGWNLVENHLLHNGDMQGSYPLLNNAPKYQVGERIRVILDCEDNTLS 211
            :.||..||.||:|.|..||||.|..|.|.|:|....|||.........|.:|:.:::|.:..||.
Zfish   118 SPLQASGYKALIGGDSCSWGWELSTNQLWHDGKEGRSYPGGGATGVLSVPDRVLLVVDADAGTLG 182

  Fly   212 FEKNYEFLGVAFRGLP-DKKLYPTVSAVYGNTEVSMVYL-GTPLD 254
            :..:..:|||||:.|| ..:|:|.||.|:|..|:.:.|| ||..|
Zfish   183 YVVDDCYLGVAFQDLPKGVELFPAVSCVWGGAEICIRYLSGTTRD 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsnNP_610849.1 F-box-like 13..54 CDD:289689
SPRY_Fbox 81..255 CDD:293964 74/175 (42%)
si:ch1073-228j22.2XP_021325532.1 SPRY 53..221 CDD:322017 69/167 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027590at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.