DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fsn and fbxo45

DIOPT Version :9

Sequence 1:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_012825639.1 Gene:fbxo45 / 100216147 XenbaseID:XB-GENE-972343 Length:282 Species:Xenopus tropicalis


Alignment Length:244 Identity:172/244 - (70%)
Similarity:202/244 - (82%) Gaps:1/244 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLEVIFSYLELDDLSHCSQVCKSWYHFLN-DENSDVWRWHCLNKLPKESLKSDLLASVSTYKTKL 76
            |||::||||:|.||..|..|||.||..|: ||||:|||..|...:.:|:|::|:|.::.|||.|:
 Frog    39 VLELVFSYLDLPDLRSCGLVCKHWYRCLHGDENSEVWRSLCGRIVSEEALRTDILCNLPTYKAKM 103

  Fly    77 RAYFHAWSPNDCSRNVYIKPNGFTLHRNPVAQSTDAARGKIGFRHGRHTWEVIWEGPLGTVAVIG 141
            ||:.|.:|.:|||||||||.|||||||||:|||||.||.||||..|||.|||.||||||||||||
 Frog   104 RAFQHGFSSSDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIG 168

  Fly   142 ISTKEAALQCHGYVALLGSDDQSWGWNLVENHLLHNGDMQGSYPLLNNAPKYQVGERIRVILDCE 206
            |:||.|.:||.||||||||||||||||||:|:|||||::.||:|..|||||||:|||||||||.|
 Frog   169 IATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDME 233

  Fly   207 DNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMVYLGTPLDG 255
            |.||:||:.||||||||||||...|||.||||||||||::||||.||||
 Frog   234 DKTLAFERGYEFLGVAFRGLPKTCLYPAVSAVYGNTEVTLVYLGKPLDG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsnNP_610849.1 F-box-like 13..54 CDD:289689 25/41 (61%)
SPRY_Fbox 81..255 CDD:293964 135/173 (78%)
fbxo45XP_012825639.1 F-box-like 34..79 CDD:372399 24/39 (62%)
SPRY_Fbox 108..282 CDD:293964 135/173 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 210 1.000 Domainoid score I2782
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14713
Inparanoid 1 1.050 366 1.000 Inparanoid score I2111
OMA 1 1.010 - - QHG45658
OrthoDB 1 1.010 - - D1027590at2759
OrthoFinder 1 1.000 - - FOG0007019
OrthoInspector 1 1.000 - - oto105467
Panther 1 1.100 - - LDO PTHR12245
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2525
SonicParanoid 1 1.000 - - X5114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.