DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4646 and YCR090C

DIOPT Version :10

Sequence 1:NP_610848.1 Gene:CG4646 / 36459 FlyBaseID:FBgn0033810 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_010014.1 Gene:YCR090C / 850452 SGDID:S000000686 Length:182 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:52/182 - (28%)
Similarity:83/182 - (45%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LQISATL-ENVDKLETSHPDYS---FFLKLKCSNCGEQSDKWHDI-TESERVQQDSRNAAGFNFF 65
            |.:.||| |||.|:...:.:.|   |...|:|::|.|..|....| |..|.....|:..|  :|.
Yeast     5 LVLKATLSENVTKVSIENTNESRAEFAFDLQCTSCRELHDSKVIINTFEEYAMPASKGTA--SFL 67

  Fly    66 MKCKMCSRENSIDIVDKSNAPYT--ADDSGA-FKTI----------------VVFECRGAEPVEF 111
            ||||.||:|.|:::....:...|  :||..| .|.:                :..:|||.|.::|
Yeast    68 MKCKFCSKELSVNLCAFEDEYLTDQSDDKWAKIKDVRKKHGLSKVKEDSFIPLSLDCRGCELIKF 132

  Fly   112 SP-RVGWRVSSAENGQQFEEVDLSEDDWVEYDQKNNNSVGIYEFASKFIKLK 162
            .| .:.:.||.:..  :.....|.:::|.:||......|.:.:|:|..||.|
Yeast   133 YPDTITFEVSLSSG--KVMSCQLEDNEWYDYDDNLGEEVTMTDFSSSIIKGK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4646NP_610848.1 CXXC_Zn-b_euk 6..158 CDD:461777 49/176 (28%)
YCR090CNP_010014.1 CXXC_Zn-b_euk 5..178 CDD:461777 49/176 (28%)

Return to query results.
Submit another query.