DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4646 and YCR090C

DIOPT Version :9

Sequence 1:NP_001286382.1 Gene:CG4646 / 36459 FlyBaseID:FBgn0033810 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_010014.1 Gene:YCR090C / 850452 SGDID:S000000686 Length:182 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:52/182 - (28%)
Similarity:83/182 - (45%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LQISATL-ENVDKLETSHPDYS---FFLKLKCSNCGEQSDKWHDI-TESERVQQDSRNAAGFNFF 65
            |.:.||| |||.|:...:.:.|   |...|:|::|.|..|....| |..|.....|:..|  :|.
Yeast     5 LVLKATLSENVTKVSIENTNESRAEFAFDLQCTSCRELHDSKVIINTFEEYAMPASKGTA--SFL 67

  Fly    66 MKCKMCSRENSIDIVDKSNAPYT--ADDSGA-FKTI----------------VVFECRGAEPVEF 111
            ||||.||:|.|:::....:...|  :||..| .|.:                :..:|||.|.::|
Yeast    68 MKCKFCSKELSVNLCAFEDEYLTDQSDDKWAKIKDVRKKHGLSKVKEDSFIPLSLDCRGCELIKF 132

  Fly   112 SP-RVGWRVSSAENGQQFEEVDLSEDDWVEYDQKNNNSVGIYEFASKFIKLK 162
            .| .:.:.||.:..  :.....|.:::|.:||......|.:.:|:|..||.|
Yeast   133 YPDTITFEVSLSSG--KVMSCQLEDNEWYDYDDNLGEEVTMTDFSSSIIKGK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4646NP_001286382.1 DUF866 6..158 CDD:283540 49/176 (28%)
YCR090CNP_010014.1 DUF866 5..178 CDD:399121 49/176 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346266
Domainoid 1 1.000 49 1.000 Domainoid score I2952
eggNOG 1 0.900 - - E1_KOG1296
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41206
Inparanoid 1 1.050 53 1.000 Inparanoid score I1820
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55802
OrthoFinder 1 1.000 - - FOG0004899
OrthoInspector 1 1.000 - - oto99610
orthoMCL 1 0.900 - - OOG6_102587
Panther 1 1.100 - - LDO PTHR12857
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2340
SonicParanoid 1 1.000 - - X3456
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.