DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4646 and Czib

DIOPT Version :9

Sequence 1:NP_001286382.1 Gene:CG4646 / 36459 FlyBaseID:FBgn0033810 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_083030.1 Gene:Czib / 74098 MGIID:1921348 Length:196 Species:Mus musculus


Alignment Length:159 Identity:72/159 - (45%)
Similarity:102/159 - (64%) Gaps:3/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVGLQISATLENVDKLETSHPDYSFFLKLKCSNCGEQSDKWHDITESERVQ-QDSRNAAGFNFFM 66
            ::.||:.||||||..|.....|:.::||:||.||||.|:||..|...:.|. :..|.:|  :...
Mouse    39 KIALQLKATLENVTNLRPVGEDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGSA--SMVQ 101

  Fly    67 KCKMCSRENSIDIVDKSNAPYTADDSGAFKTIVVFECRGAEPVEFSPRVGWRVSSAENGQQFEEV 131
            |||:|:|||||||:..:...|.|:|:..|||||.|||||.|||:|.|:.|:.....|:|..|.::
Mouse   102 KCKLCARENSIDILSSTIKAYNAEDNEKFKTIVEFECRGLEPVDFQPQAGFAADGVESGTVFSDI 166

  Fly   132 DLSEDDWVEYDQKNNNSVGIYEFASKFIK 160
            :|.|.||.:||:|...||||:|...:|:|
Mouse   167 NLQEKDWTDYDEKAQESVGIFEVTHQFVK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4646NP_001286382.1 DUF866 6..158 CDD:283540 70/152 (46%)
CzibNP_083030.1 DUF866 42..193 CDD:283540 70/152 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849577
Domainoid 1 1.000 147 1.000 Domainoid score I4509
eggNOG 1 0.900 - - E1_KOG1296
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41206
Inparanoid 1 1.050 152 1.000 Inparanoid score I4328
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55802
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004899
OrthoInspector 1 1.000 - - oto93531
orthoMCL 1 0.900 - - OOG6_102587
Panther 1 1.100 - - LDO PTHR12857
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2340
SonicParanoid 1 1.000 - - X3456
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.