DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4646 and czib

DIOPT Version :9

Sequence 1:NP_001286382.1 Gene:CG4646 / 36459 FlyBaseID:FBgn0033810 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001122157.1 Gene:czib / 555997 ZFINID:ZDB-GENE-061207-34 Length:160 Species:Danio rerio


Alignment Length:161 Identity:81/161 - (50%)
Similarity:106/161 - (65%) Gaps:3/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRVGLQISATLENVDKLETSHPDYSFFLKLKCSNCGEQSDKWHDITESERVQ-QDSRNAAGFNF 64
            |.:.|||..||||||..:.....|:.::|||||.||||.||||..||..:.:. :..|.:|  :.
Zfish     1 MGKFGLQFKATLENVTNVRPEGEDFRWYLKLKCGNCGEVSDKWQYITLLDSMPLKGGRGSA--SM 63

  Fly    65 FMKCKMCSRENSIDIVDKSNAPYTADDSGAFKTIVVFECRGAEPVEFSPRVGWRVSSAENGQQFE 129
            ..|||:|||||||||:..:..||.|:||..|||:|.|||||.|||:|.|:.|:..|.||...||.
Zfish    64 VQKCKLCSRENSIDILKDTITPYNAEDSERFKTVVQFECRGLEPVDFQPQAGFAASGAETSTQFP 128

  Fly   130 EVDLSEDDWVEYDQKNNNSVGIYEFASKFIK 160
            |::|.|.||.:||:|.:.||||||...:|:|
Zfish   129 EINLQEKDWTDYDEKASESVGIYEVTHQFVK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4646NP_001286382.1 DUF866 6..158 CDD:283540 77/152 (51%)
czibNP_001122157.1 DUF866 6..157 CDD:283540 77/152 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595311
Domainoid 1 1.000 160 1.000 Domainoid score I4031
eggNOG 1 0.900 - - E1_KOG1296
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41206
Inparanoid 1 1.050 166 1.000 Inparanoid score I4159
OMA 1 1.010 - - QHG55802
OrthoDB 1 1.010 - - D1398309at2759
OrthoFinder 1 1.000 - - FOG0004899
OrthoInspector 1 1.000 - - oto38621
orthoMCL 1 0.900 - - OOG6_102587
Panther 1 1.100 - - LDO PTHR12857
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2340
SonicParanoid 1 1.000 - - X3456
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.