DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4646 and CZIB

DIOPT Version :10

Sequence 1:NP_610848.1 Gene:CG4646 / 36459 FlyBaseID:FBgn0033810 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_060357.1 Gene:CZIB / 54987 HGNCID:26059 Length:160 Species:Homo sapiens


Alignment Length:161 Identity:74/161 - (45%)
Similarity:104/161 - (64%) Gaps:3/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRVGLQISATLENVDKLETSHPDYSFFLKLKCSNCGEQSDKWHDITESERVQ-QDSRNAAGFNF 64
            |.::.||:.|||||:..|.....|:.::||:||.||||.||||..|...:.|. :..|.:|  :.
Human     1 MGKIALQLKATLENITNLRPVGEDFRWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGSA--SM 63

  Fly    65 FMKCKMCSRENSIDIVDKSNAPYTADDSGAFKTIVVFECRGAEPVEFSPRVGWRVSSAENGQQFE 129
            ..|||:|:|||||:|:..:..||.|:|:..|||||.|||||.|||:|.|:.|:.....|:|..|.
Human    64 VQKCKLCARENSIEILSSTIKPYNAEDNENFKTIVEFECRGLEPVDFQPQAGFAAEGVESGTAFS 128

  Fly   130 EVDLSEDDWVEYDQKNNNSVGIYEFASKFIK 160
            :::|.|.||.:||:|...||||||...:|:|
Human   129 DINLQEKDWTDYDEKAQESVGIYEVTHQFVK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4646NP_610848.1 CXXC_Zn-b_euk 6..158 CDD:461777 71/152 (47%)
CZIBNP_060357.1 CXXC_Zn-b_euk 6..157 CDD:461777 71/152 (47%)

Return to query results.
Submit another query.