DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4646 and SPBC2D10.03c

DIOPT Version :9

Sequence 1:NP_001286382.1 Gene:CG4646 / 36459 FlyBaseID:FBgn0033810 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001018829.2 Gene:SPBC2D10.03c / 3361316 PomBaseID:SPBC2D10.03c Length:157 Species:Schizosaccharomyces pombe


Alignment Length:154 Identity:53/154 - (34%)
Similarity:80/154 - (51%) Gaps:10/154 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRVGLQISATLENVDKLETSHPDYSFF--LKLKCSNCGEQSDKWHDITESERVQ-QDSRNAAGF 62
            |.:..|.::|.|..|..|.....: ||:  .|::||.|.|..|...:|:.||... ..|:..|  
pombe     1 MGKFALNLNAELTGVKNLAPKDEE-SFYYAFKVQCSGCREIHDNAIEISRSETHSIPGSKGEA-- 62

  Fly    63 NFFMKCKMCSRENSIDIVDKSNAPYTADDSGAFKTIVVFECRGAEPVEFSPRVGWRVSSAENGQQ 127
            |....||.|.:..|. :::...:||  :||...|.::|.||||.|.|||.|:..|..:.||:...
pombe    63 NLIWTCKNCRKTCSF-VIEGPFSPY--NDSQETKKVLVLECRGCELVEFIPQGEWIANGAESNTL 124

  Fly   128 FEEVDLSEDDWVEYDQKNNNSVGI 151
            |:|:.| ||||.:||:..::.|.|
pombe   125 FDEIVL-EDDWYDYDENASSEVSI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4646NP_001286382.1 DUF866 6..158 CDD:283540 52/149 (35%)
SPBC2D10.03cNP_001018829.2 DUF866 6..154 CDD:283540 52/149 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I2488
eggNOG 1 0.900 - - E1_KOG1296
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41206
Inparanoid 1 1.050 76 1.000 Inparanoid score I1885
OMA 1 1.010 - - QHG55802
OrthoFinder 1 1.000 - - FOG0004899
OrthoInspector 1 1.000 - - oto101240
orthoMCL 1 0.900 - - OOG6_102587
Panther 1 1.100 - - LDO PTHR12857
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2340
SonicParanoid 1 1.000 - - X3456
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.