DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4646 and Czib

DIOPT Version :9

Sequence 1:NP_001286382.1 Gene:CG4646 / 36459 FlyBaseID:FBgn0033810 Length:163 Species:Drosophila melanogaster
Sequence 2:XP_006238570.1 Gene:Czib / 298384 RGDID:1559786 Length:177 Species:Rattus norvegicus


Alignment Length:178 Identity:72/178 - (40%)
Similarity:103/178 - (57%) Gaps:20/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRVGLQISATLENVDKLETSHPDYSFFLK-----------------LKCSNCGEQSDKWHDITE 48
            |.::.||:.||||||..|.....|:.::||                 :||.||||.|:||..|..
  Rat     1 MGKIALQLKATLENVTNLRPVGEDFRWYLKVRRKTDFSWEGEEHPEAMKCGNCGEISEKWQYIRL 65

  Fly    49 SERVQ-QDSRNAAGFNFFMKCKMCSRENSIDIVDKSNAPYTADDSGAFKTIVVFECRGAEPVEFS 112
            .:.|. :..|.:|  :...|||:|:|||||:|:..:...|.|:|:..|||||.|||||.|||:|.
  Rat    66 MDSVALKGGRGSA--SMVQKCKLCARENSIEILSSTIKSYNAEDNEKFKTIVEFECRGLEPVDFQ 128

  Fly   113 PRVGWRVSSAENGQQFEEVDLSEDDWVEYDQKNNNSVGIYEFASKFIK 160
            |:.|:.....|:|..|.:::|.|.||.:||:|...||||:|...:|:|
  Rat   129 PQAGFAAEGVESGTVFSDINLQEKDWTDYDEKTQESVGIFEVTHQFVK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4646NP_001286382.1 DUF866 6..158 CDD:283540 69/169 (41%)
CzibXP_006238570.1 DUF866 6..174 CDD:283540 69/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353223
Domainoid 1 1.000 146 1.000 Domainoid score I4448
eggNOG 1 0.900 - - E1_KOG1296
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41206
Inparanoid 1 1.050 152 1.000 Inparanoid score I4270
OMA 1 1.010 - - QHG55802
OrthoDB 1 1.010 - - D1398309at2759
OrthoFinder 1 1.000 - - FOG0004899
OrthoInspector 1 1.000 - - oto97073
orthoMCL 1 0.900 - - OOG6_102587
Panther 1 1.100 - - LDO PTHR12857
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.