DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4646 and F46B6.12

DIOPT Version :9

Sequence 1:NP_001286382.1 Gene:CG4646 / 36459 FlyBaseID:FBgn0033810 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_505521.2 Gene:F46B6.12 / 179370 WormBaseID:WBGene00009776 Length:167 Species:Caenorhabditis elegans


Alignment Length:161 Identity:58/161 - (36%)
Similarity:89/161 - (55%) Gaps:4/161 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VGLQISATLENVDKLETSHPD-YSFFLKLKCSNCGEQSDKWHDITESERVQ-QDSRNAAGFNFFM 66
            :.|::...|:.:..|.....| :.:.:||||:||||..|.|..:..:|.:. ..||..|  |...
 Worm     4 LALELKCQLKGITDLRPDDTDSFHWHMKLKCTNCGEAPDHWQYVVLNEMLDVPGSRGEA--NLVE 66

  Fly    67 KCKMCSRENSIDIVDKSNAPYTADDSGAFKTIVVFECRGAEPVEFSPRVGWRVSSAENGQQFEEV 131
            |||:|.|.|::.||:.....|..:.:..::.|.||:|||.||.:|.||..|...|.|.|..|.|:
 Worm    67 KCKLCGRVNTLTIVEDMFKSYNIEQNEKWQQIAVFDCRGLEPFDFDPRDEWIAKSVETGNAFHEI 131

  Fly   132 DLSEDDWVEYDQKNNNSVGIYEFASKFIKLK 162
            ||||.:||::|.|...:|.|.|.:|:|..::
 Worm   132 DLSEKEWVDFDDKAMEAVEISEMSSQFTTIR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4646NP_001286382.1 DUF866 6..158 CDD:283540 57/153 (37%)
F46B6.12NP_505521.2 DUF866 6..158 CDD:283540 57/153 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166773
Domainoid 1 1.000 114 1.000 Domainoid score I3811
eggNOG 1 0.900 - - E1_KOG1296
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41206
Inparanoid 1 1.050 115 1.000 Inparanoid score I3399
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55802
OrthoDB 1 1.010 - - D1398309at2759
OrthoFinder 1 1.000 - - FOG0004899
OrthoInspector 1 1.000 - - oto20070
orthoMCL 1 0.900 - - OOG6_102587
Panther 1 1.100 - - LDO PTHR12857
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2340
SonicParanoid 1 1.000 - - X3456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.