DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4630 and SVOP

DIOPT Version :9

Sequence 1:NP_001260948.1 Gene:CG4630 / 36458 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_061181.1 Gene:SVOP / 55530 HGNCID:25417 Length:548 Species:Homo sapiens


Alignment Length:468 Identity:118/468 - (25%)
Similarity:193/468 - (41%) Gaps:105/468 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LQCPENL--WKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFLFCIVFMALTGVAQALSWDYIS 215
            |.|...|  |::|.:.::.|.|::..:.|.|.::|:||||......:::....|:..|.:..|..
Human   111 LHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSW 175

  Fly   216 FLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVG---EALLGLSVFLPD--WR 275
            .|....|...|..|| |.:..:..|.:..:.|....:::..|:|:|   |.:|.:.| :|.  ||
Human   176 ILVLRGLVGFGIGGV-PQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFV-MPSLGWR 238

  Fly   276 QLQLALSVPPLI-CVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRRDISVELMASFKQQEL 339
            .|.:..:||.|: .|..||| |||.|:.:....:|:|...::|.|..|...:.:..:...:|:  
Human   239 WLLILSAVPLLLFAVLCFWL-PESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQE-- 300

  Fly   340 DAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAILLL--IWAVNAIVYYGLSLNATS- 401
              :.|:                   ::::...|.   |:..|||  ||..||..||||.|..|. 
Human   301 --DRGK-------------------MRDLFTPHF---RWTTLLLWFIWFSNAFSYYGLVLLTTEL 341

  Fly   402 --------------------------LSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGS 440
                                      ||...|::.....|.|.||..:....:.|.||:..::..
Human   342 FQAGDVCGISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALC 406

  Fly   441 LLL---CSI---TCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVI 499
            .::   ||:   .||....:||                           |..:.:..|:..|...
Human   407 FVIFSFCSLLLFICVGRNVLTL---------------------------LLFIARAFISGGFQAA 444

  Fly   500 YTFTAEMMPTVIRSGGVGVMSTFARFGAMLAPF---VPLLASYYDPLPLLLFGTLSLVAGLLSLL 561
            |.:|.|:.||..|:.|:|..|..||.||::.||   |.|.:|.|  |.|.::....|:|.|.|..
Human   445 YVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVY--LTLAVYSGCCLLAALASCF 507

  Fly   562 LP-ETFNRKLPDT 573
            || ||..|.|.::
Human   508 LPIETKGRGLQES 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 118/466 (25%)
MFS 158..533 CDD:119392 100/420 (24%)
SVOPNP_061181.1 MFS_SVOP 87..509 CDD:340999 112/455 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.