DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4630 and T05A1.5

DIOPT Version :9

Sequence 1:NP_001260948.1 Gene:CG4630 / 36458 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:277 Identity:56/277 - (20%)
Similarity:116/277 - (41%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PWSAWPLDQCFAENFTTETERCNQFVYGSSERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTA 178
            |.|...||.|   :|.|..   |:|   :..:|::.      |..:     ..:|.|.|..:...
 Worm   109 PSSPCTLDNC---SFVTVQ---NEF---NITKTLID------PGEM-----TSSIFFLGNGILGQ 153

  Fly   179 LSGYLADRYGRKHIFLFCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVG 243
            :....|||.||:.:.:..:....|:|:..|.:..:...|..........:.:..:.:::..|.:.
 Worm   154 IYAVAADRIGRRPVLIASLFISGLSGIGAAYAPTFEIMLIGRFFQGSCFTALTMINWVMCCESIS 218

  Fly   244 PRKREMSSIVLNYFYAVGEALLG-LSVFLPDWRQLQLALSVPPLICVAY----FWLVPESVRWLL 303
            ......:|::....:.:|...:. |:::...||.:|||.|||   ||.:    .:.:|||..:|:
 Worm   219 FSGHGYASVLFGLCWVIGYCSVSPLAMYFSTWRYVQLATSVP---CVLFGILMMFTLPESFSFLV 280

  Fly   304 ARNRREQAGVIIRRAAKVNRRDISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEV 368
            |:.:|:.....|..|::|...:|..:     ..|.:|..:.:||          ::.:...:|.|
 Worm   281 AKRKRDDLVKWIEMASRVGNEEIDYD-----ADQIVDMSSREED----------NESLLQTLKLV 330

  Fly   369 ARSHILMGRYAILLLIW 385
            .:|.:::...|:...:|
 Worm   331 LQSKLMVTNTAVETFLW 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 56/277 (20%)
MFS 158..533 CDD:119392 45/233 (19%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 33/176 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D386678at33208
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.