DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4627 and tmem186

DIOPT Version :9

Sequence 1:NP_610846.2 Gene:CG4627 / 36457 FlyBaseID:FBgn0033808 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001129456.1 Gene:tmem186 / 799142 ZFINID:ZDB-GENE-081022-122 Length:228 Species:Danio rerio


Alignment Length:205 Identity:56/205 - (27%)
Similarity:97/205 - (47%) Gaps:39/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RLPWRSCMSLAIQPAQRRRFATEAAGKRTETEKSAFTEWRTVYSMPGIRLVAALSRLKVYQAVIT 76
            ::|..|..:..|.||.   |:::.|.::          :..:|:.|.||.:.||||||:.|..||
Zfish    49 QMPNTSTHTTRIHPAS---FSSDLASRK----------YSLIYAFPLIRGLRALSRLKLLQTGIT 100

  Fly    77 AAGTPIVFALGSAGQLSTDALAIYAAIGV---TGLITLTLASYASSNLVGFIYVNEEQDLLKLAY 138
            ....|.|:.|...||.|  .|.:..:||:   .|::..:::.:. ..:||.:|::..|.:||:::
Zfish   101 VVLLPTVYYLHLQGQAS--VLVLNRSIGIALFAGVMLYSISHFV-RRVVGMMYLDSTQTILKVSH 162

  Fly   139 VDFWGRRQETLIETEDLLPSWEQG---SPSRLRFVSPICLRSDSKRRYKLLN------RFGHVSD 194
            :.|||.|::..:...|::...:.|   ..|.||.           :||...|      |.|.|.|
Zfish   163 LSFWGHRRDIYVPVSDVVTLGDSGDSRGESILRL-----------KRYSTSNTMYFSTRLGRVVD 216

  Fly   195 RQLFEGLFGN 204
            |..|..:||:
Zfish   217 RHAFGKVFGS 226



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596594
Domainoid 1 1.000 72 1.000 Domainoid score I9351
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5297
OMA 1 1.010 - - QHG50937
OrthoDB 1 1.010 - - D1296527at2759
OrthoFinder 1 1.000 - - FOG0007035
OrthoInspector 1 1.000 - - oto38777
orthoMCL 1 0.900 - - OOG6_108717
Panther 1 1.100 - - LDO PTHR13603
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5022
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.