DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4627 and Tmem186

DIOPT Version :9

Sequence 1:NP_610846.2 Gene:CG4627 / 36457 FlyBaseID:FBgn0033808 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_079984.2 Gene:Tmem186 / 66690 MGIID:1913940 Length:216 Species:Mus musculus


Alignment Length:212 Identity:64/212 - (30%)
Similarity:98/212 - (46%) Gaps:15/212 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LELLCRVSPA-------RLPWRSCMSLAIQPAQRRRFATEAAGKRTETEKSAFTE---WRTVYSM 56
            :..|.||.|.       |.|.:.....:.|...:|...:.:...|   |||..||   :.|:|..
Mouse     1 MAFLLRVVPRLQGPTAWRRPLQGLWCCSGQGDSKRWVGSRSPHSR---EKSPGTETETFHTIYRF 62

  Fly    57 PGIRLVAALSRLKVYQAVITAAGTPIVFALGSAGQLSTDALAIYAAIGVTGLITLTLASYASSNL 121
            ..||.:..|||||:.|..:|....|..|...|.|.::..:|.:...:....|..|...|:....|
Mouse    63 RAIRAIGFLSRLKLAQTAVTVVALPPGFYCYSQGLMTLSSLCLLGGVASFALAMLCWMSHFFRRL 127

  Fly   122 VGFIYVNEEQDLLKLAYVDFWGRRQETLIETEDLLPSWEQGSPSRLRFVSPICLRSDSKRRYKLL 186
            ||.:||||...||::|::.|||.||:|.....|::|..|  |..|::.|.....:...|:.:.|.
Mouse   128 VGILYVNESGTLLRVAHLTFWGWRQDTYCAVSDMIPLSE--SQERVQDVFVRIQQYSGKQTFYLT 190

  Fly   187 NRFGHVSDRQLFEGLFG 203
            .|:|.:.||:.|..:||
Mouse   191 LRYGRILDRERFAQVFG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4627NP_610846.2 None
Tmem186NP_079984.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..52 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850613
Domainoid 1 1.000 88 1.000 Domainoid score I7968
eggNOG 1 0.900 - - E1_2BD24
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5121
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50937
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007035
OrthoInspector 1 1.000 - - oto91958
orthoMCL 1 0.900 - - OOG6_108717
Panther 1 1.100 - - LDO PTHR13603
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5022
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.