DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4627 and Tmem186

DIOPT Version :9

Sequence 1:NP_610846.2 Gene:CG4627 / 36457 FlyBaseID:FBgn0033808 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001020927.1 Gene:Tmem186 / 497863 RGDID:1561167 Length:216 Species:Rattus norvegicus


Alignment Length:202 Identity:63/202 - (31%)
Similarity:95/202 - (47%) Gaps:18/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELLCRVSPA-RLPWRSCMSLAIQPAQRRRFATEAAGKRTETEKSAFTEWRTVYSMPGIRLVAALS 66
            :|.||.... .:.|....|   .|:|.:       ...|||||     :.|:|....||.:..||
  Rat    23 QLWCRAGQGDSIRWVGSRS---PPSQEK-------PPGTETEK-----FHTIYRFNAIRALGFLS 72

  Fly    67 RLKVYQAVITAAGTPIVFALGSAGQLSTDALAIYAAIGVTGLITLTLASYASSNLVGFIYVNEEQ 131
            |||:.|..:|....|..|...|.|.::..:|.:.:.|....|:.|...|:....|||.:||||..
  Rat    73 RLKLAQTAVTVVALPPGFYCYSQGLMTLSSLGLMSGIASFALVMLCWMSHFFRRLVGILYVNESG 137

  Fly   132 DLLKLAYVDFWGRRQETLIETEDLLPSWEQGSPSRLRFVSPICLRSDSKRRYKLLNRFGHVSDRQ 196
            .||::|::.|||.||:|.....|::|..|  |..|::.|.....:...|:.:.|..|:|.:.||.
  Rat   138 TLLRVAHLTFWGWRQDTYCAVSDMIPLSE--SEERVQDVFVRIQQYSGKQTFYLTLRYGRILDRD 200

  Fly   197 LFEGLFG 203
            .|..:||
  Rat   201 RFSQVFG 207



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354310
Domainoid 1 1.000 91 1.000 Domainoid score I7531
eggNOG 1 0.900 - - E1_2BD24
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5014
OMA 1 1.010 - - QHG50937
OrthoDB 1 1.010 - - D1296527at2759
OrthoFinder 1 1.000 - - FOG0007035
OrthoInspector 1 1.000 - - otm44431
orthoMCL 1 0.900 - - OOG6_108717
Panther 1 1.100 - - LDO PTHR13603
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.