DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4627 and TMEM186

DIOPT Version :9

Sequence 1:NP_610846.2 Gene:CG4627 / 36457 FlyBaseID:FBgn0033808 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_056236.2 Gene:TMEM186 / 25880 HGNCID:24530 Length:213 Species:Homo sapiens


Alignment Length:163 Identity:53/163 - (32%)
Similarity:80/163 - (49%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ETEKSAFTEWRTVYSMPGIRLVAALSRLKVYQAVITAAGTPIVFALGSAGQLSTDALAIYAAIGV 105
            ||||.    | ..|....||....|||||:.|..:|....|..:.|.|.|.|:.:.:.:.:.|..
Human    52 ETEKF----W-MFYRFDAIRTFGFLSRLKLAQTALTVVALPPGYYLYSQGLLTLNTVCLMSGISG 111

  Fly   106 TGLITLTLASYASSNLVGFIYVNEEQDLLKLAYVDFWGRRQETLIETEDLLPSWEQGSPSRLRFV 170
            ..|..|...||....|||.:|:||...:|::|:::|||.||:|.....|::|..|.....:..||
Human   112 FALTMLCWMSYFLRRLVGILYLNESGTMLRVAHLNFWGWRQDTYCPMADVIPLTETKDRPQEMFV 176

  Fly   171 SPICLRSDSKRRYKLLNRFGHVSDRQLFEGLFG 203
            .  ..|...|:.:.:..|:|.:.||:.|..:||
Human   177 R--IQRYSGKQTFYVTLRYGRILDRERFTQVFG 207



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160261
Domainoid 1 1.000 81 1.000 Domainoid score I8598
eggNOG 1 0.900 - - E1_2BD24
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5225
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50937
OrthoDB 1 1.010 - - D1296527at2759
OrthoFinder 1 1.000 - - FOG0007035
OrthoInspector 1 1.000 - - oto88386
orthoMCL 1 0.900 - - OOG6_108717
Panther 1 1.100 - - LDO PTHR13603
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5022
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.