DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4627 and tmem186

DIOPT Version :9

Sequence 1:NP_610846.2 Gene:CG4627 / 36457 FlyBaseID:FBgn0033808 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_002939485.2 Gene:tmem186 / 100497442 XenbaseID:XB-GENE-940697 Length:242 Species:Xenopus tropicalis


Alignment Length:227 Identity:63/227 - (27%)
Similarity:104/227 - (45%) Gaps:43/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELLCRVS---PARLPWRSCM----------SLAIQPAQRRRFATEA----AGKRTETEKSAFTEW 50
            :||||.:   .:.:...||.          |.|..|...:.:.:.:    || .:.|||  ||  
 Frog    24 KLLCRTTFFRSSSVSLTSCQGCSYLFLHHRSKAPLPLMNQIYFSSSPPLLAG-ISNTEK--FT-- 83

  Fly    51 RTVYSMPGIRLVAALSRLKVYQAVITAAGTPIVFALGSAGQLS------TDALAIYAAIGVTGLI 109
             .:|..|||:...|:||||:.|..:||...|.::.....||::      :...|::|     ||:
 Frog    84 -MIYKFPGIKYCRAVSRLKLLQTALTAIFLPPMYYYYIQGQVTYLWVVYSTGTALFA-----GLM 142

  Fly   110 TLTLASYASSNLVGFIYVNEEQDLLKLAYVDFWGRRQETLIETEDLLPSWEQGSPSR---LRFVS 171
            ...|:.|. ..::|.||:|.....||::::.|||:|::..|..:|:....|.|...|   |:|  
 Frog   143 LYCLSFYL-RRIIGMIYLNTAGTTLKVSHLTFWGKRKDLYIPIDDVKALSETGDHRRETILQF-- 204

  Fly   172 PICLRSDSKRRYKLLNRFGHVSDRQLFEGLFG 203
               .|..|.......::||.:.|::.|..|||
 Frog   205 ---KRYSSSDTLYFTSQFGIILDKEKFIRLFG 233



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9931
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5189
OMA 1 1.010 - - QHG50937
OrthoDB 1 1.010 - - D1296527at2759
OrthoFinder 1 1.000 - - FOG0007035
OrthoInspector 1 1.000 - - oto102271
Panther 1 1.100 - - LDO PTHR13603
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.