DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AQP and DELTA-TIP

DIOPT Version :9

Sequence 1:NP_523728.1 Gene:AQP / 36456 FlyBaseID:FBgn0033807 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_188245.1 Gene:DELTA-TIP / 820870 AraportID:AT3G16240 Length:250 Species:Arabidopsis thaliana


Alignment Length:254 Identity:59/254 - (23%)
Similarity:90/254 - (35%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AQIARVISRRLVTREGLVPILINEAIAAAELCACCFELIIVADNFGVSMYAVC----LFLLTIWW 80
            |.:|..||..|....|     :..|||.|:|.:..     ..|..|:...|||    ||:.....
plant    20 AYLAEFISTLLFVFAG-----VGSAIAYAKLTSDA-----ALDTPGLVAIAVCHGFALFVAVAIG 74

  Fly    81 GRVWGDASACPYTHMEDVVEGRTSFKEMALRSWAELMGGCCVYRVVQVFWWLE-----------L 134
            ..:.|.       |:...|            ::...:|| .:..:..||:|:.           |
plant    75 ANISGG-------HVNPAV------------TFGLAVGG-QITVITGVFYWIAQLLGSTAACFLL 119

  Fly   135 AETHRGRAFEACNADMQVSPYLGAVIEGVATLLCRLASKTISEKEPRFGSYIDSFIGTSLVVAVY 199
            .....|.|....:....:....|.|:|.:.| ...:.:...:..:|:.||     :||   :|..
plant   120 KYVTGGLAVPTHSVAAGLGSIEGVVMEIIIT-FALVYTVYATAADPKKGS-----LGT---IAPL 175

  Fly   200 AFNYV----LLAAFNFSGGYFNPV--LATALKWG-CRGHTHLEHIIVYWIGACAGAVLS 251
            |...:    :|||..||||..||.  ...|:..| ..||.      |||:|...|..|:
plant   176 AIGLIVGANILAAGPFSGGSMNPARSFGPAVAAGDFSGHW------VYWVGPLIGGGLA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AQPNP_523728.1 None
DELTA-TIPNP_188245.1 MIP 1..244 CDD:412216 59/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.