DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AQP and AQP12B

DIOPT Version :9

Sequence 1:NP_523728.1 Gene:AQP / 36456 FlyBaseID:FBgn0033807 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_011509973.1 Gene:AQP12B / 653437 HGNCID:6096 Length:544 Species:Homo sapiens


Alignment Length:265 Identity:71/265 - (26%)
Similarity:120/265 - (45%) Gaps:22/265 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGISALFMVGCCALAQIARVISRRLVTREGLVPILINEAIAAAELCACCFELIIV------ADNF 64
            |.:|..|......|.:.||..|:.|:. .|...:...||:.|.:|.||..|:..:      |.:|
Human     4 LNVSLSFFFATFTLCEAARRASKALLP-VGAYEVFAREAVGAVQLGACFLEMRTLVELGPWAGDF 67

  Fly    65 GVSMYAVCLFLLTIWWGRVWGDASACPYTHMEDVVEGRTSFKEMALRSWAELMGGCCVYRVVQVF 129
            |..:....||||.:..|.....|||.|...:::.:....|.....|:..|:.:|......:.::.
Human    68 GPDLLLTLLFLLFLAHGVTLDGASANPTVSLQEFLMAEESLPGTLLKLAAQGLGMQAACTLTRLC 132

  Fly   130 WWLELAETH--RGRAFEACNADMQVSPYLGAVIEGVATLLCRLASKTISEKEPRFGSYIDSFIGT 192
            |..||::.|  :....::|::.::.|...||::|........|....:....|.:     |....
Human   133 WAWELSDLHLLQSLMAQSCSSALRTSVPHGALVEAACAFCFHLTLLHLRHSPPAY-----SGPAV 192

  Fly   193 SLVVAVYAFNYVLLAAFNFSGGYFNPVLATALKWGCRGHTHLEHIIVYWIGACAGAV---LSIPV 254
            :|:|.|.|:     .|..|:..:|||.||.::.:.|.|||.||::.|||:|...|||   |::..
Human   193 ALLVTVTAY-----TAGPFTSAFFNPALAASVTFACSGHTLLEYVQVYWLGPLTGAVTACLTVDT 252

  Fly   255 FKVPA 259
            ..||:
Human   253 VPVPS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AQPNP_523728.1 None
AQP12BXP_011509973.1 MIP <89..248 CDD:294134 44/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158448
Domainoid 1 1.000 72 1.000 Domainoid score I9326
eggNOG 1 0.900 - - E1_2A80J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5178
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1080106at2759
OrthoFinder 1 1.000 - - FOG0005875
OrthoInspector 1 1.000 - - otm41908
orthoMCL 1 0.900 - - OOG6_109463
Panther 1 1.100 - - O PTHR21191
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.