DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AQP and aqp12

DIOPT Version :9

Sequence 1:NP_523728.1 Gene:AQP / 36456 FlyBaseID:FBgn0033807 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001039327.1 Gene:aqp12 / 436844 ZFINID:ZDB-GENE-040718-310 Length:276 Species:Danio rerio


Alignment Length:281 Identity:74/281 - (26%)
Similarity:118/281 - (41%) Gaps:43/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LAQIARVISRRLVTREGLVPILINEAIAAAELCACCFELIIVAD------NFGVSMYAVCLFLLT 77
            ||.:...:|.||:.|...|   :.|.::|..||||..|:..:|:      ..|..:....|||..
Zfish    12 LAVVGLSVSGRLLLRRWTV---LLELVSAFALCACRLEVDTIAEVGQWAGALGPDVAVTMLFLSI 73

  Fly    78 IWWGRVWGDASACPYTHMEDVVEGRTSFKEMALRSWAELMGGCCVYRVVQVFWWLELAETH--RG 140
            .....|..|.|..|...:..:::...|.....|...|:|:|......|...||.:||::.|  :.
Zfish    74 AVHTAVMQDVSGNPAVTLLRLLQRDVSVVVAVLSIAAQLIGAFLALEVAGRFWAMELSDMHMIKN 138

  Fly   141 RAFEACNADMQVSPYLGAVIEGVAT---LLCRLASKTISE--KEPRFGSYIDSFIGTSLVVAVYA 200
            .....|:..::||..||...|.:|.   ||..|..|..|:  |.|.        :..:|.:..|.
Zfish   139 LMMSECSTSLRVSTALGVSTEALAALLLLLLHLVLKNRSQMLKVPA--------LSVALTLIAYT 195

  Fly   201 FNYVLLAAFNFSGGYFNPVLATALKWGCRGHTHLEHIIVYWIGACAGAVLSIPVF--KVPAV--- 260
            .|       |::.||.||.||.|:.:.|.||:.|.:.:|||:|...|..|::.::  .:|.:   
Zfish   196 AN-------NYTSGYVNPALAYAVTFTCPGHSFLVYSLVYWLGPLIGVFLAVFLYLGNIPLLFSK 253

  Fly   261 -------RRLLLGEGAASKSK 274
                   .|..|.:|..:..|
Zfish   254 NLLYSKKNRFRLPKGKTNDEK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AQPNP_523728.1 None
aqp12NP_001039327.1 MIP 41..243 CDD:294134 59/216 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594376
Domainoid 1 1.000 76 1.000 Domainoid score I8986
eggNOG 1 0.900 - - E1_2A80J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5170
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1080106at2759
OrthoFinder 1 1.000 - - FOG0005875
OrthoInspector 1 1.000 - - otm24434
orthoMCL 1 0.900 - - OOG6_109463
Panther 1 1.100 - - O PTHR21191
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5152
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.