DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AQP and AQP12A

DIOPT Version :9

Sequence 1:NP_523728.1 Gene:AQP / 36456 FlyBaseID:FBgn0033807 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_945349.1 Gene:AQP12A / 375318 HGNCID:19941 Length:295 Species:Homo sapiens


Alignment Length:268 Identity:71/268 - (26%)
Similarity:122/268 - (45%) Gaps:23/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGISALFMVGCCALAQIARVISRRLVTREGLVPILINEAIAAAELCACCFELIIVADNFGVSMYA 70
            |.:|..|.....||.:.||..|:      .|:|:...| :.|.|......||...|.:||..:..
Human     4 LNVSLSFFFATFALCEAARRASK------ALLPVGAYE-VFAREAMRTLVELGPWAGDFGPDLLL 61

  Fly    71 VCLFLLTIWWGRVWGDASACPYTHMEDVVEGRTSFKEMALRSWAELMGGCCVYRVVQVFWWLELA 135
            ..||||.:..|.....|||.|...:::.:....|.....|:..|:.:|......::::.|..||:
Human    62 TLLFLLFLAHGVTLDGASANPTVSLQEFLMAEQSLPGTLLKLAAQGLGMQAACTLMRLCWAWELS 126

  Fly   136 ETH--RGRAFEACNADMQVSPYLGAVIEGVATLLCRLASKTISEKEPRFGSYIDSFIGTSLVVAV 198
            :.|  :....::|::.::.|...||::|........|....:....|.:     |....:|:|.|
Human   127 DLHLLQSLMAQSCSSALRTSVPHGALVEAACAFCFHLTLLHLRHSPPAY-----SGPAVALLVTV 186

  Fly   199 YAFNYVLLAAFNFSGGYFNPVLATALKWGCRGHTHLEHIIVYWIGACAGAVLSIPVF--KVPAV- 260
            .|:     .|..|:..:|||.||.::.:.|.|||.||::.|||:|...|.||::.:.  ::|.: 
Human   187 TAY-----TAGPFTSAFFNPALAASVTFACSGHTLLEYVQVYWLGPLTGMVLAVLLHQGRLPHLF 246

  Fly   261 -RRLLLGE 267
             |.|..|:
Human   247 QRNLFYGQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AQPNP_523728.1 None
AQP12ANP_945349.1 MIP <77..239 CDD:294134 44/171 (26%)
NPA 1 81..83 0/1 (0%)
NPA 2 200..202 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158449
Domainoid 1 1.000 72 1.000 Domainoid score I9326
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5178
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1080106at2759
OrthoFinder 1 1.000 - - FOG0005875
OrthoInspector 1 1.000 - - otm41908
orthoMCL 1 0.900 - - OOG6_109463
Panther 1 1.100 - - O PTHR21191
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.