DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AQP and aqp-9

DIOPT Version :9

Sequence 1:NP_523728.1 Gene:AQP / 36456 FlyBaseID:FBgn0033807 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001251148.1 Gene:aqp-9 / 3565336 WormBaseID:WBGene00000177 Length:269 Species:Caenorhabditis elegans


Alignment Length:256 Identity:66/256 - (25%)
Similarity:113/256 - (44%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SALFMVGCCALAQIAR-VISRRLVTREGLVPILINEAIAAAELCACCFELIIVADNF---GVSMY 69
            |.:|.....|:.::.| ::.:.....:.|..:||.|.|...::|...|::..:.||:   ||.:.
 Worm     7 SLIFYGSVFAICELLRFLVIKSFDNSKRLSALLILEFIGTLQICVPMFDVGTILDNYGLLGVFVE 71

  Fly    70 AVCLFLLTIWWGRVWGDASA--CP-----YTHMEDVVEGRTSFKEMALRSWAELMGGCCVYRVVQ 127
            ...:.|...::.|   ||.|  ||     |...:.:..|...|       ..:|......|.|.:
 Worm    72 ITVIELANCYFQR---DAVAHPCPLVTNCYRKSKAIRRGIYVF-------LVQLAAAYLSYFVAR 126

  Fly   128 VFW-------WLELAETHRGRAFEACNADMQVSPYLGAVIEGVATLLCRLASKTISEK---EPRF 182
            :||       .|||.:.      |:|::|:.|:...|.:||||||.:.:...|.:.|:   |.:.
 Worm   127 LFWSIGVHPIHLELLDA------ESCSSDLTVAITTGCIIEGVATFVAKWFEKYVDERYDGETKL 185

  Fly   183 GSYIDSFIGTSLVVAVYAFNYVLLA-AFNFSGGYFNPVLATALKWGCRGHTHLEHIIVYWI 242
            .|           :|...|:.:|.| ..|::|.|.||::|.|..:.|.|.:|..|:.|||:
 Worm   186 CS-----------IANCLFSGLLCAIGINYTGMYANPIVAWACTFNCLGVSHAGHLFVYWL 235



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166109
Domainoid 1 1.000 71 1.000 Domainoid score I6222
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3898
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28887
OrthoDB 1 1.010 - - D1080106at2759
OrthoFinder 1 1.000 - - FOG0005875
OrthoInspector 1 1.000 - - otm14550
orthoMCL 1 0.900 - - OOG6_109463
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5152
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.