DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AQP and aqp-10

DIOPT Version :9

Sequence 1:NP_523728.1 Gene:AQP / 36456 FlyBaseID:FBgn0033807 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_496105.1 Gene:aqp-10 / 174537 WormBaseID:WBGene00000178 Length:280 Species:Caenorhabditis elegans


Alignment Length:265 Identity:66/265 - (24%)
Similarity:112/265 - (42%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TALGISAL-FMVGCCALAQIARVISRRLVTREGLVPILINEAIAAAELCACCFELIIVADNFGVS 67
            :|||..|| |.:|     :|||:|:.:.|:..|...:.:.|.|...::|.|.:|..|:..|:|..
 Worm    14 SALGYFALVFGIG-----EIARIITAKYVSPRGNSQLFLYELIGTIQMCTCVYENGIIFKNYGFP 73

  Fly    68 MYAVCLFLLTIWWGRVW--GDASACPYTHMEDVVEGRTSFKEMALRSWAELMGGCCVYRVVQVFW 130
            ...:|:.|| :..|.::  |..:.|.....:.|.....|.|.:.:.| |:|:|.....:...:.|
 Worm    74 AIFICVALL-LTAGNIFNRGAMTNCAPIFEQFVFGNLGSSKFLTILS-AQLIGATFASKFAYLIW 136

  Fly   131 WLELAETHRGRAFEACNADMQVSPYLGAVIEGVATLLCRLASKTISEKEPRF---GSYIDSFIGT 192
            .:                   .:||..|.:|..:.|.|.|..|..:.....|   |:::...:..
 Worm   137 NI-------------------TAPYSTAHLENASNLECILHYKQTAGIVIGFEIVGAFVVRIVVA 182

  Fly   193 SLVV----------AVYAFNYVLLAAFNFSGGYFNPVLATALKWGCRGHTHLEHIIVYW----IG 243
            .|:.          |:.|  |:.||.:.......||::|||..:||||..:....|:||    :|
 Worm   183 QLLARPALIKLIPFAISA--YLSLALYVVGVPGLNPIVATARLYGCRGIDNSSFFILYWFCPVLG 245

  Fly   244 ACAGA 248
            ...||
 Worm   246 WLTGA 250



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166107
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1080106at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14550
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21191
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5152
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.