DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AQP and aqp11

DIOPT Version :9

Sequence 1:NP_523728.1 Gene:AQP / 36456 FlyBaseID:FBgn0033807 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_004912256.2 Gene:aqp11 / 100038073 XenbaseID:XB-GENE-481474 Length:281 Species:Xenopus tropicalis


Alignment Length:255 Identity:68/255 - (26%)
Similarity:112/255 - (43%) Gaps:22/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TALGISALFMVGCCALAQIARVISRRLVTREGLVPILINEAIAAAELCACCFELII------VAD 62
            :||..|||.::|.....:..|.:|.:.: |:||...|:.|.|...:||.|..|..:      :..
 Frog    15 SALWGSALLVLGIVLQCEALRAVSGKGL-RDGLPKELLREVICTFQLCCCVREQALLGWEGALTP 78

  Fly    63 NFGVSMYAVCLFLLTIWWGRVWGDASACPYTHMEDVVEGRTSFKEMALRSWAELMGGCCVYRVVQ 127
            ..|:::    .|||::..| :...|...|...:|..:.|..:..:..||..|:.:|.......:.
 Frog    79 RLGLTL----TFLLSLLHG-LTARAVCNPSGSLERYLRGEEAAPQSCLRLCAQFLGAWLSRLAMP 138

  Fly   128 VFWWLELAETHRGRAFEACNADMQVSPYLGAVIEGVATLLCRLASKTISEKEPRFGSYIDSFIGT 192
            .:|.|.|:..|..:|.....:.:||:...||.:|    |||.|....:....||.....      
 Frog   139 CYWLLGLSPLHGPQASHCPRSPLQVALLPGAGVE----LLCSLGMFCLLRHLPRLPPPF------ 193

  Fly   193 SLVVAVYAFNYVLLAAFNFSGGYFNPVLATALKWGCRGHTHLEHIIVYWIGACAGAVLSI 252
            .:..|..|...::....:.:|..|||.||.||.:.|.|:|..|:.:|||.|...|.:||:
 Frog   194 RVQTAALAITGLVWLGGSLTGAVFNPALAYALLFHCEGNTFPEYALVYWAGPVTGMLLSV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AQPNP_523728.1 None
aqp11XP_004912256.2 MIP <125..255 CDD:412216 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8612
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5068
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005875
OrthoInspector 1 1.000 - - otm49131
Panther 1 1.100 - - LDO PTHR21191
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.