DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG34303

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001356898.1 Gene:CG34303 / 5740723 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster


Alignment Length:183 Identity:42/183 - (22%)
Similarity:79/183 - (43%) Gaps:35/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YDIFQLSEPNIVYKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQIL 65
            ::||.:|:.:..||..::.|..: |.......|.|:||:....:..:..:|.:.:..:.|.|:::
  Fly    14 FNIFVISKVHGSYKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSAFLNKTISEVEIHFKMV 78

  Fly    66 KKDYSNKFQPFLVDVVINMCDAL-SRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYL-- 127
            |::... :.||..|:.|::|... :||.|....| |....:.::|.||:|||     ..|..:  
  Fly    79 KRERGG-WHPFFYDIRIDVCQFFKNRRGFFISNL-IYSFIKPYTNVNHTCPY-----MEGTEMRL 136

  Fly   128 -----NESYLPNVFPL--GFYKFNITIMENYITPPSAHVGGIIWYVQAMHAIQ 173
                 :|..:...||:  |.|....|                 |||:...|::
  Fly   137 WNWSPDEDAVLAKFPVDHGTYGLQTT-----------------WYVKKEAALK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 23/100 (23%)
CG34303NP_001356898.1 DUF1091 73..157 CDD:310821 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
33.010

Return to query results.
Submit another query.