DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33632

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:150 Identity:43/150 - (28%)
Similarity:79/150 - (52%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFQLSEPNIVYKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILK 66
            |:.|:|...:.:..|::|.|: ..||....|:::::|.:.....:.|.||: |:..|.::|.:.|
  Fly    16 IYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYK 80

  Fly    67 KDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHL-MARGAYLNES 130
            :  .|.::|||.::.::.|..|..|:..|..|....:.:.:||.||:|||...| :...:|.:.:
  Fly    81 R--LNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSIN 143

  Fly   131 Y-----LPNVFPLGFYKFNI 145
            |     ||  ||.|.||..:
  Fly   144 YKLTEILP--FPEGNYKLEV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 25/78 (32%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 26/84 (31%)

Return to query results.
Submit another query.