DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG12849

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:123 Identity:30/123 - (24%)
Similarity:57/123 - (46%) Gaps:14/123 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKDYSNKFQPFLVDVVINMCDALSRRSFIPY 96
            |:::::|.......:...:.| |:.|...|||:..::  |:...:..|..::.|..:..|..:  
  Fly    41 CYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMRE--NRRVLYNFDFKVDSCKFMRDRKHV-- 101

  Fly    97 GLIILKIARTF---SNFNHSCPYRGHLMARG---AYLNESYLPNVFPLGFYKFNITIM 148
              |...:.:||   ||.||:|||...::...   .:||: .:.::.|.|.|..|.|.|
  Fly   102 --IANWVYQTFGPYSNLNHTCPYDHDIVLDKLPVQHLNK-LVQSIIPDGRYMMNSTWM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 21/82 (26%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472604
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.