DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33658

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:132 Identity:33/132 - (25%)
Similarity:59/132 - (44%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NIECSTVPGFSANAS-CHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFLVDVV 81
            |.:|:::....|:.. |.::::|.........:.:|:.|.::.:.|.:.::  .|.::|||.::.
  Fly    32 NFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQ--INGYKPFLYNIT 94

  Fly    82 INMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNE---SYLPNV--FPLGFY 141
            |:.|..:................|..||.|||||| .|.:......:|   |.||..  ||.|.|
  Fly    95 IDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPY-NHDIIMEKLTSETINSRLPKTLPFPTGNY 158

  Fly   142 KF 143
            .|
  Fly   159 MF 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 24/76 (32%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 24/76 (32%)

Return to query results.
Submit another query.