DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33630

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:126 Identity:30/126 - (23%)
Similarity:50/126 - (39%) Gaps:25/126 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 INWNKAVAEMDVYLLRPL------YNITIRFQILKKDYSNKFQPFLVDVVINMCDALSRRSFIPY 96
            |:.:::..::.|.|:..|      .||.:|   :|.:.||.|........||.|:.||..:..|.
  Fly    58 IHEDRSHFDLHVQLVHELGSNHLIMNIKVR---VKPEGSNAFVQLFELRRINFCEFLSEYNTNPM 119

  Fly    97 GLIILKIARTFSNFNHS----CPYRGHLMARGAYLNESYLPNV----FPLGFYKFNITIME 149
            ..::.|     .|...:    ||.|   :...:.||.....|:    ...|.|:|...|:|
  Fly   120 MEMMFK-----KNVKLNDIIVCPVR---VGNYSLLNSDIAENIHADGVQNGTYRFFAEIVE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 20/85 (24%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.